Arg-Lys-Asp-Val-Tyr-Molbase

: Check Encyclopedia

Thymopentin

CAS No. : 69558-55-0 Formula : C30H49N9O9 Molecular Weight. : 679.765 Check Encyclopedia

Synonyms : thymopoietin fragment 32-36; TP-5; Timunox; HArgLysAspValTyrOH; Immunox; RKDVY; THYMOPENTIN 5; Arg-Lys-Asp-Val-Tyr; thymopoietin; THYMOPETIN; Sintomodulina;

Supplier : All (121) China Suppliers (91) Price Available (24) Contractor (30)

Recommended Supplier	Purity	Lead Time	Packing	Price
Win-Win Chemical CO., Limited	98%	3Day (s)	10g/瓶	Request For Qutation
Hangzhou J&H Chemical Co., Ltd.	98%	14Day (s)	1kg	Request For Qutation
Simagchem Corp.	99%	3Day (s)	25kg/桶	Request For Qutation
OpChem(Changzhou) Co.,Ltd.	99%	14Day (s)	1kg	Request For Qutation
Baoji Guokang Bio-Technology Co., Ltd	98%	14Day (s)	1200mg	$1034

More Suppliers

: Check Encyclopedia

(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-amino-5-(diaminomethylideneamino)pentanoyl]amino]hexanoyl]amino]-3-carboxypropanoyl]amino]-3-methylbutanoic acid

CAS No. : 85466-18-8 Formula : C21H40N8O7 Molecular Weight. : 516.592 Check Encyclopedia

Synonyms : Thymocartin; Rgh 0206; Thymocartine [INN-French]; Thymocartina [INN-Spanish]; Thymocartinum [INN-Latin]; Thymocartina;

Supplier : All (10) China Suppliers (3) Contractor (2)

Recommended Supplier	Purity	Lead Time	Packing	Price
Hangzhou J&H Chemical Co., Ltd.	98%	7Day (s)	1kg	Request For Qutation
Career Henan Chemical Co	0.98	3Day (s)	10g	Request For Qutation
American Custom Chemicals Corporation	96%	7Day (s)	500g	Request For Qutation
Nanjing Leon biological technology Co. LTD	98%	7Day (s)	50g	Request For Qutation
Ibookbio	96%	7Day (s)	500g	Request For Qutation

More Suppliers

: Check Encyclopedia

GLY-GLU-GLN-ARG-LYS-ASP-VAL-TYR-VAL-GLN-LEU-TYR-LEU

CAS No. : 56795-64-3 Formula : C73H115N19O22 Molecular Weight. : 1610.81 Check Encyclopedia

Synonyms : GLY-GLU-GLN-ARG-LYS-ASP-VAL-TYR-VAL-GLU-LEU-TYR-LEU; THYMOPOIETIN II FRAGMENT 29-41; gly-glu-gln-arg-lys-asp-val-tyr-val-*gln-leu-tyr; thymopoietin II,bovine,fragment 29-41;

Supplier : All (5) China Suppliers (2) Contractor (2)

Recommended Supplier	Purity	Lead Time	Packing	Price
Hangzhou J&H Chemical Co., Ltd.	98%	14Day (s)	1kg	Request For Qutation
Career Henan Chemical Co	98%	3Day (s)	10g	Request For Qutation
American Custom Chemicals Corporation	96%	7Day (s)	100g	Request For Qutation
Research Plus, Inc.	95%	7Day (s)	500g	Request For Qutation
American Peptide Company	95%	14Day (s)	25kg	Request For Qutation

More Suppliers

: Check Encyclopedia

Arg-Lys-Asp-Val-Tyr-Glu-Glu-Ala-Glu-Asn

CAS No. : 123167-51-1 Formula : C52H81N15O21 Molecular Weight. : 1252.29 Check Encyclopedia

Synonyms : Decapeptide-2;

Supplier : All (2) China Suppliers (2) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price
Win-Win Chemical CO., Limited	98%	3Day (s)	10g/瓶	Request For Qutation
Career Henan Chemical Co	0.98	3Day (s)	10g	Request For Qutation
Nanjing Sibai Biochemical Industry Co., Ltd.	98%	IN STOCK	1g	Request For Qutation

More Suppliers

: Check Encyclopedia

GTP-Binding Protein Fragment, Gs α

CAS No. : 101038-78-2 Formula : C85H144N30O24S Molecular Weight. : 2002.3 Check Encyclopedia

Synonyms : H-CYS-LYS-GLN-LEU-GLN-LYS-ASP-LYS-GLN-VAL-TYR-ARG-ALA-THR-HIS-ARG-OH;

Supplier : All (5) China Suppliers (3) Price Available (1) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price
Career Henan Chemical Co	98%	3Day (s)	10g	$1
Zhejiang Peptites Biotech Co.,Ltd	0.98	7Day (s)	1g	Request For Qutation
Shenzhen Regent Biochemistry Technology CO., Ltd.	96%	7Day (s)	10g	Request For Qutation
Ibookbio	96%	7Day (s)	100g	Request For Qutation
American Peptide Company	95%	14Day (s)	1吨	Request For Qutation

More Suppliers

: Check Encyclopedia

PACAP 1-38,PituitaryAdenylateCyclase-ActivatingPolypeptide1-38

CAS No. : 138764-85-9 Formula : C47H83N17O11 Molecular Weight. : 1062.27 Check Encyclopedia

Synonyms : TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2; PACAP 1-38; PITUITARY ADENYLATE CYCLASE-ACTIVATING POLYPEPTIDE 1-38; H-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2;

Supplier : All (9) China Suppliers (4) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price
BOC Sciences	≥98%	1Week (s)	5mg	$298
Career Henan Chemical Co	98%	3Day (s)	10g	Request For Qutation
Chengdu SinoStandards Bio-Tech Co.,Ltd.	98%	7Day (s)	1mg	Request For Qutation
Hefei Saimanuo Biotechnology Co., Ltd.	95%	7Day (s)	1g	Request For Qutation
Nanjing Leon biological technology Co. LTD	98%	7Day (s)	50g	Request For Qutation

More Suppliers

: Check Encyclopedia

cyclo<-Arg-Lys-Asp-Val-D-Tyr->

CAS No. : 100164-85-0 Formula : C32H51N9O10 Molecular Weight. : 721.802 Check Encyclopedia

Synonyms : compound with acetic acid; cyclo(-Arg-Lys-Asp-Val-D-Tyr-); [(2S,5S,8R,11S,14S)-14-(4-Amino-butyl)-11-(3-guanidino-propyl)-8-(4-hydroxy-benzyl)-5-isopropyl-3,6,9,12,15-pentaoxo-1,4,7,10,13-pentaaza-cyclopentadec-2-yl]-acetic acid;

Supplier : All (1) China Suppliers (1) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price	View
Hangzhou J&H Chemical Co., Ltd.	98%	3Day (s)	10g	Request For Qutation

More Suppliers

: Check Encyclopedia

127317-03-7

CAS No. : 127317-03-7 Formula : C142H224N40O39S Molecular Weight. : 3147.61 Check Encyclopedia

Synonyms : ADENYLATE CYCLASE ACTIVATING PEPTIDE-27; Talopram hydrochloride;

Supplier : All (34) China Suppliers (13) Price Available (2) Contractor (3)

Recommended Supplier	Purity	Lead Time	Packing	Price
BOC Sciences	≥98% by HPLC	1Week (s)	1mg	$439
Win-Win Chemical CO., Limited	98%	3Day (s)	10g/瓶	Request For Qutation
Hangzhou J&H Chemical Co., Ltd.	98%	7Day (s)	1g	Request For Qutation
Career Henan Chemical Co	98%	3Day (s)	1kg	Request For Qutation
Sichuan Jisheng Biotechnology Co.,Ltd	98%	14Day (s)	1g	Request For Qutation

More Suppliers

: Check Encyclopedia

Acetyl-Lys0,Nle3-g2-MSH amide

CAS No. : 237761-41-0 Formula : C86H127N23O19S Molecular Weight. : 1819.14 Check Encyclopedia

Synonyms : ACETYL-(LYS0,NLE3)-GAMMA2-MSH AMIDE; ACETYL-(LYS0,NLE3)-GAMMA2 MELANOCYTE STIMULATING HORMONE AMIDE; Acetyl-(Lys0,Nle3)-g2-MSH amide; Ac-[Lys0,Nle3]-g2-MSH amide;

Supplier : All (9) China Suppliers (5) Contractor (2)

Recommended Supplier	Purity	Lead Time	Packing	Price
Hangzhou J&H Chemical Co., Ltd.	98%	14Day (s)	1kg	Request For Qutation
Career Henan Chemical Co	0.98	3Day (s)	10g	Request For Qutation
Chengdu SinoStandards Bio-Tech Co.,Ltd.	98%	7Day (s)	25mg	Request For Qutation
Hefei Saimanuo Biotechnology Co., Ltd.	95%	7Day (s)	1g	Request For Qutation
Nanjing Leon biological technology Co. LTD	98%	7Day (s)	50g	Request For Qutation

More Suppliers

: Check Encyclopedia

cyclo<-Arg(NO2)-Lys(Z)-Asp(OBzl)-Val-D-Tyr->

CAS No. : 100017-93-4 Formula : C45H58N10O12 Molecular Weight. : 931.002 Check Encyclopedia

Synonyms : cyclo<-Arg(NO2)-Lys(Z)-Asp(OBn)-Val-D-Tyr->; cyclo[-Arg(NO2)-Lys(Z)-Asp(OBzl)-Val-D-Tyr->;

Supplier : All (1) China Suppliers (1) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price	View
Hangzhou J&H Chemical Co., Ltd.	98%	7Day (s)	1kg	Request For Qutation

More Suppliers

: Check Encyclopedia

cyclo<-Tyr-Val-Arg-Lys-Asp-D-Val->*2HOAc

CAS No. : 100366-04-9 Formula : C37H60N10O11 Molecular Weight. : 820.933 Check Encyclopedia

Synonyms : compound with acetic acid; cyclo[-Tyr-Val-Arg-Lys-Asp-D-Val->*2HOAc; [(2S,5R,8S,11S,14S,17S)-17-(4-Amino-butyl)-14-(3-guanidino-propyl)-8-(4-hydroxy-benzyl)-5,11-diisopropyl-3,6,9,12,15,18-hexaoxo-1,4,7,10,13,16-hexaaza-cyclooctadec-2-yl]-acetic acid;

Supplier : All (1) China Suppliers (1) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price	View
Hangzhou J&H Chemical Co., Ltd.	98%	7Day (s)	1kg	Request For Qutation

More Suppliers

: Check Encyclopedia

(D-PHE2)-VIP (HUMAN, BOVINE, PORCINE, RAT)

CAS No. : 104051-15-2 Formula : C153H242N44O41S Molecular Weight. : 3385.89 Check Encyclopedia

Synonyms : H-His-D-Phe-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2;

Supplier : All (8) China Suppliers (3) Price Available (1) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price
Career Henan Chemical Co	98%	3Day (s)	1kg	$2
Skyrun Industrial Co., Limited	99%	7Day (s)	25kg	Request For Qutation
Shenzhen Regent Biochemistry Technology CO., Ltd.	96%	7Day (s)	100g	Request For Qutation
Ibookbio	96%	7Day (s)	100g	Request For Qutation
Brunschwig chemie	95%	14Day (s)	1吨	Request For Qutation

More Suppliers

: Check Encyclopedia

UNII-SQD60KZ8RJ

CAS No. : 463930-25-8 Formula : C167H270N52O46 Molecular Weight. : 3742.25 Check Encyclopedia

Synonyms : His-ser-asp-ala-val-phe-thr-asp-asn-tyr-thr-arg-leu-arg-lys-gln-val-ala-ala-lys-lys-tyr-leu-gln-ser-ile-lys-asp-lys-arg-tyr-NH2; BAY-55-9837;

Supplier : All (5) China Suppliers (3) Price Available (2) Contractor (2)

Recommended Supplier	Purity	Lead Time	Packing	Price
Career Henan Chemical Co	98%	3Day (s)	10g	$1
ShangHai WeiHuan Biotech CO.,Ltd	98%	3Day (s)	10mg	$60
Chengdu SinoStandards Bio-Tech Co.,Ltd.	98%	7Day (s)	1mg	Request For Qutation
American Custom Chemicals Corporation	96%	7Day (s)	500g	Request For Qutation
Tocris Bioscience	95%	7Day (s)	500g	Request For Qutation

More Suppliers

: Check Encyclopedia

Factor XIIIa Fragment 72-97

CAS No. : 158053-05-5 Formula : C144H222N42O43 Molecular Weight. : 3229.56 Check Encyclopedia

Synonyms : Asn-Lys-Leu-Ile-Val-Arg-Arg-Gly-Gln-Ser-Phe-Tyr-Val-Gln-Ile-Asp-Phe-Ser-Arg-Pro-Tyr-Asp-Pro-Arg-Arg-Asp;

Supplier : All (2) China Suppliers (1) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price	View
Career Henan Chemical Co	98%	3Day (s)	10g	Request For Qutation
American Custom Chemicals Corporation	96%	7Day (s)	10g	Request For Qutation

More Suppliers

: Check Encyclopedia

ACTIVATED PROTEIN C (390-404) (HUMAN)

CAS No. : 146340-20-7 Formula : C91H130N22O23 Molecular Weight. : 1900.14 Check Encyclopedia

Synonyms : H-TYR-GLY-VAL-TYR-THR-LYS-VAL-SER-ARG-TYR-LEU-ASP-TRP-ILE-HIS-OH; TYR-GLY-VAL-TYR-THR-LYS-VAL-SER-ARG-TYR-LEU-ASP-TRP-ILE-HISH-TYR-GLY-VAL-TYR-THR-LYS-VAL-SER-ARG-TYR-LEU-ASP-TRP-ILE-HIS-OH; PROTEIN C,ACTIVATED,FRAGMENT 390-404; ProteinC,Activated,Fragment 390-404 human; TYR-GLY-VAL-TYR-THR-LYS-VAL-SER-ARG-TYR-LEU-ASP-TRP-ILE-HIS; YGVYTKVSRYLDWIH;

Supplier : All (5) China Suppliers (3)

Recommended Supplier	Purity	Lead Time	Packing	Price
Chengdu SinoStandards Bio-Tech Co.,Ltd.	98%	7Day (s)	500μg	Request For Qutation
Hefei Saimanuo Biotechnology Co., Ltd.	95%	7Day (s)	1g	Request For Qutation
Nanjing Leon biological technology Co. LTD	98%	7Day (s)	50g	Request For Qutation
Ibookbio	96%	7Day (s)	500g	Request For Qutation
Bachem AG	96%	7Day (s)	25kg	Request For Qutation

More Suppliers

: Check Encyclopedia

Nmu-25

CAS No. : 98395-76-7 Formula : C144H217N43O37 Molecular Weight. : 3142.53 Check Encyclopedia

Synonyms : Neuromedin U-25 porcine;

Supplier : All (10) China Suppliers (5) Contractor (2)

Recommended Supplier	Purity	Lead Time	Packing	Price
Hangzhou J&H Chemical Co., Ltd.	99%	14Day (s)	500g	Request For Qutation
Career Henan Chemical Co	0.98	3Day (s)	2g	Request For Qutation
Chengdu SinoStandards Bio-Tech Co.,Ltd.	98%	7Day (s)	1mg	Request For Qutation
Hefei Saimanuo Biotechnology Co., Ltd.	95%	7Day (s)	1g	Request For Qutation
Nanjing Leon biological technology Co. LTD	98%	7Day (s)	10g	Request For Qutation

More Suppliers

: Check Encyclopedia

(D-ALA2)-GRF (1-29) AMIDE (HUMAN)

CAS No. : 89453-59-8 Formula : C149H246N44O42S Molecular Weight. : 3357.88 Check Encyclopedia

Synonyms : H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2; TYR-D-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;

Supplier : All (12) China Suppliers (4) Contractor (2)

Recommended Supplier	Purity	Lead Time	Packing	Price
Hangzhou J&H Chemical Co., Ltd.	98%	7Day (s)	1kg	Request For Qutation
Career Henan Chemical Co	98%	3Day (s)	10g	Request For Qutation
Hefei Saimanuo Biotechnology Co., Ltd.	95%	7Day (s)	1g	Request For Qutation
American Custom Chemicals Corporation	96%	7Day (s)	10g	Request For Qutation
Nanjing Leon biological technology Co. LTD	98%	7Day (s)	5g	Request For Qutation

More Suppliers

: Check Encyclopedia

cyclo<-Tyr-Arg-D-Lys-Asp-D-Val->*2AcOH

CAS No. : 100164-91-8 Formula : C32H51N9O10 Molecular Weight. : 721.802 Check Encyclopedia

Synonyms : cyclo[-Tyr-Arg-D-Lys-Asp-D-Val->*2AcOH; compound with acetic acid; [(2S,5R,8S,11S,14R)-14-(4-Amino-butyl)-11-(3-guanidino-propyl)-8-(4-hydroxy-benzyl)-5-isopropyl-3,6,9,12,15-pentaoxo-1,4,7,10,13-pentaaza-cyclopentadec-2-yl]-acetic acid;

Supplier : All (1) China Suppliers (1) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price	View
Hangzhou J&H Chemical Co., Ltd.	98%	7Day (s)	100kg	Request For Qutation

More Suppliers

: Check Encyclopedia

[Ala11,22,28]VIP

CAS No. : 291524-04-4 Formula : C139H231N43O39S Molecular Weight. : 3160.65 Check Encyclopedia

Synonyms : M.W. 3160.65 C139H231N43O39S; HIS-SER-ASP-ALA-VAL-PHE-THR-ASP-ASN-TYR-ALA-ARG-LEU-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-ALA-LEU-ASN-SER-ILE-LEU-ALA-NH2; H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Ala-Leu-Asn-Ser-Ile-Leu-Ala-NH2;

Supplier : All (15) China Suppliers (5) Price Available (2) Contractor (4)

Recommended Supplier	Purity	Lead Time	Packing	Price
Hangzhou J&H Chemical Co., Ltd.	98%	14Day (s)	1kg	Request For Qutation
Career Henan Chemical Co	98%	3Day (s)	10g	Request For Qutation
ShangHai WeiHuan Biotech CO.,Ltd	98%	3Day (s)	10mg	$159
PolyPeptide Laboratories	95%	7Day (s)	0.5mg	$105
Chengdu SinoStandards Bio-Tech Co.,Ltd.	98%	7Day (s)	1mg	Request For Qutation

More Suppliers

: Check Encyclopedia

(Z-DEVD)2-Rh 110

CAS No. : 223538-61-2 Formula : Molecular Weight. : Check Encyclopedia

Synonyms : [M.W. 3160.65 C139H231N43O39S, HIS-SER-ASP-ALA-VAL-PHE-THR-ASP-ASN-TYR-ALA-ARG-LEU-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-ALA-LEU-ASN-SER-ILE-LEU-ALA-NH2, H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Ala-Leu-Asn-Ser-Ile-Leu-Ala-NH2];

Supplier : All (1) China Suppliers (1) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price	View
Hangzhou J&H Chemical Co., Ltd.	≥97%	14Day (s)	1kg	Request For Qutation

More Suppliers

All Categories