TYR-GLU-Molbase

: Check Encyclopedia

P60c-src Substrate II, Phosphorylated

CAS No. : 284660-72-6 Formula : C30H41N6O10P Molecular Weight. : 676.655 Check Encyclopedia

Synonyms : SRC SUBSTRATE II,PHOSPHORYLATED; AC-IPYGEF-NH2; AC-ILE-TYR(PO3H2)-GLY-GLU-PHE-NH2; AC-IY(PO3H2)GEF-NH2;

Supplier : All (8) China Suppliers (4) Contractor (2)

Recommended Supplier	Purity	Lead Time	Packing	Price
Hangzhou J&H Chemical Co., Ltd.	98%	14Day (s)	1kg	Request For Qutation
Career Henan Chemical Co	0.98	3Day (s)	1kg	Request For Qutation
Chengdu SinoStandards Bio-Tech Co.,Ltd.	98%	7Day (s)	25mg	Request For Qutation
Nanjing Leon biological technology Co. LTD	98%	7Day (s)	100g	Request For Qutation
Ibookbio	96%	7Day (s)	500g	Request For Qutation

More Suppliers

: Check Encyclopedia

cyclo<-Arg-Lys-Glu-Val-Tyr-Gly->*2HOAc

CAS No. : 100350-78-5 Formula : C35H56N10O11 Molecular Weight. : 792.88 Check Encyclopedia

Synonyms : compound with acetic acid; cyclo[-Arg-Lys-Glu-Val-Tyr-Gly->*2HOAc; 3-[(2S,5S,8S,14S,17S)-17-(4-Amino-butyl)-14-(3-guanidino-propyl)-8-(4-hydroxy-benzyl)-5-isopropyl-3,6,9,12,15,18-hexaoxo-1,4,7,10,13,16-hexaaza-cyclooctadec-2-yl]-propionic acid;

Supplier : All (1) China Suppliers (1) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price	View
Hangzhou J&H Chemical Co., Ltd.	98%	7Day (s)	100kg	Request For Qutation

More Suppliers

: Check Encyclopedia

cyclo<-Tyr-Val-Arg-Lys-Glu-D-Val->*2HOAc

CAS No. : 100350-82-1 Formula : C38H62N10O11 Molecular Weight. : 834.959 Check Encyclopedia

Synonyms : compound with acetic acid; cyclo[-Tyr-Val-Arg-Lys-Glu-D-Val->*2HOAc; 3-[(2S,5R,8S,11S,14S,17S)-17-(4-Amino-butyl)-14-(3-guanidino-propyl)-8-(4-hydroxy-benzyl)-5,11-diisopropyl-3,6,9,12,15,18-hexaoxo-1,4,7,10,13,16-hexaaza-cyclooctadec-2-yl]-propionic acid;

Supplier : All (1) China Suppliers (1) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price	View
Hangzhou J&H Chemical Co., Ltd.	98%	7Day (s)	100kg	Request For Qutation

More Suppliers

: Check Encyclopedia

HISTATIN-5

CAS No. : 104339-66-4 Formula : C133H195N51O33 Molecular Weight. : 3036.29 Check Encyclopedia

Synonyms : H-ASP-SER-HIS-ALA-LYS-ARG-HIS-HIS-GLY-TYR-LYS-ARG-LYS-PHE-HIS-GLU-LYS-HIS-HIS-SER-HIS-ARG-GLY-TYR-OH; L-Asp-L-Ser-L-His-L-Ala-L-Lys-L-Arg-L-His-L-His-Gly-L-Tyr-L-Lys-L-Arg-L-Lys-L-Phe-L-His-L-Glu-L-Lys-L-His-L-His-L-Ser-L-His-L-Arg-Gly-L-Tyr-OH; DSHAKRHHGYKRKFHEKHHSHRGY; HISTATIN 5 (HUMAN);

Supplier : All (27) China Suppliers (17) Price Available (3) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price
BOC Sciences	98%	1Week (s)	5mg	$298
Shanghai Jizhi Biochemical Technology Co., Ltd.	97%	30Day (s)	2.5mg/瓶	Request For Qutation
Dayang Chem (Hangzhou) Co., Ltd	98%	7Day (s)	1kg	Request For Qutation
Skyrun Industrial Co., Limited	99%	7Day (s)	25kg	Request For Qutation
Zhejiang Peptites Biotech Co.,Ltd	0.98	7Day (s)	1g	Request For Qutation

More Suppliers

: Check Encyclopedia

MOG (35-55)

CAS No. : 149635-73-4 Formula : C118H177N35O29S Molecular Weight. : 2581.95 Check Encyclopedia

Synonyms : MEVGWYRSPFSRVVHLYRNGK;

Supplier : All (34) China Suppliers (21) Price Available (5) Contractor (9)

Recommended Supplier	Purity	Lead Time	Packing	Price
BOC Sciences	>98%	1Week (s)	5mg	$259
Hangzhou J&H Chemical Co., Ltd.	99%	14Day (s)	500g	Request For Qutation
Simagchem Corp.	99%	3Day (s)	25kg/桶	Request For Qutation
Career Henan Chemical Co	98%	3Day (s)	1kg	Request For Qutation
SAGECHEM LIMITED	98%	7Day (s)	1kg	Request For Qutation

More Suppliers

: Check Encyclopedia

H-TYR-PHE-LEU-PHE-ARG-PRO-ARG-ASN-NH2

CAS No. : 98395-75-6 Formula : C54H78N16O10 Molecular Weight. : 1111.3 Check Encyclopedia

Synonyms : neuromedin U-8; p-NMU-8; p-Neuromedin U-8; YFLFRPRN-NH2; TYR-PHE-LEU-PHE-ARG-PRO-ARG-ASN-NH2; L-Tyr-L-Phe-L-Leu-L-Phe-L-Arg-L-Pro-L-Arg-L-Asn-NH2; porcine neuromedin U-8;

Supplier : All (12) China Suppliers (5) Contractor (2)

Recommended Supplier	Purity	Lead Time	Packing	Price
Hangzhou J&H Chemical Co., Ltd.	99%	14Day (s)	500g	Request For Qutation
Career Henan Chemical Co	98%	3Day (s)	10g	Request For Qutation
Chengdu SinoStandards Bio-Tech Co.,Ltd.	98%	7Day (s)	5mg	Request For Qutation
Hefei Saimanuo Biotechnology Co., Ltd.	95%	7Day (s)	100mg	Request For Qutation
Nanjing Leon biological technology Co. LTD	98%	7Day (s)	100g	Request For Qutation

More Suppliers

: Check Encyclopedia

His-Gly-Glu-Phe-Ala-Pro-Gly-Asn-Tyr-Pro-Ala-Leu-Trp-Ser-Tyr-Ala

CAS No. : 133531-91-6 Formula : C85H110N20O23 Molecular Weight. : 1779.9 Check Encyclopedia

Synonyms : Sendai virus Nucleoprotein Fragment 321-336;

Supplier : All (5) China Suppliers (3) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price
Career Henan Chemical Co	98%	3Day (s)	10g	Request For Qutation
Skyrun Industrial Co., Limited	99%	7Day (s)	25kg	Request For Qutation
Zhejiang Hongtuo Biotechnology Co., Ltd.	98%	5Day (s)	1g	Request For Qutation
Ibookbio	96%	7Day (s)	100g	Request For Qutation
Bachem AG	96%	7Day (s)	25kg	Request For Qutation

More Suppliers

: Check Encyclopedia

Human peptide YY (3-36)

CAS No. : 123583-37-9 Formula : Molecular Weight. : Check Encyclopedia

Synonyms : L-Isoleucyl-L-lysyl-L-prolyl-L-α-glutamyl-L-alanyl-L-prolylglycyl-L-α-glutamyl-L-α-aspartyl-L-alanyl-L-seryl-L-prolyl-L-α-glutamyl-L-α-glutamyl-L-leucyl-L-asparaginyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-alanyl-L-seryl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-leucyl-L-asparaginyl-L-leucyl-L-valyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosinamide; 3-36 Peptide YY (human); 3-36-Human peptide YY; L-Tyrosinamide, L-isoleucyl-L-lysyl-L-prolyl-L-α-glutamyl-L-alanyl-L-prolylglycyl-L-α-glutamyl-L-α-aspartyl-L-alanyl-L-seryl-L-prolyl-L-α-glutamyl-L-α-glutamyl-L-leucyl-L-asparaginyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-alanyl-L-seryl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-leucyl-L-asparaginyl-L-leucyl-L-valyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-; Peptide YG (Lophius americanus pancreatic islet), 1-de-L-tyrosine-2-de-L-proline-3-L-isoleucine-7-L-alanine-10-L-glutamic acid-11-L-aspartic acid-16-L-glutamic acid-17-L-leucine-18-L-asparagine-19-L-arginine-21-L-tyrosine-23-L-serine-24-L-leucine-28-L-leucine-31-L-valine-36-L-tyrosinamide-37-deglycine-; 4: PN: WO2011050008 SEQID: 4 claimed protein; 12: PN: US20060171920 SEQID: 12 claimed protein; 1: PN: WO2011033068 SEQID: 1 claimed protein;

Supplier : All (3) China Suppliers (1) Price Available (1) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price	View
Career Henan Chemical Co	0.98	3Day (s)	1kg	$1
Creative Peptides		7Day (s)	100g	Request For Qutation

More Suppliers

: Check Encyclopedia

NEUROPEPTIDE Y (13-36), HUMAN, RAT

CAS No. : 122341-40-6 Formula : C134H207N41O36S Molecular Weight. : 3000.4 Check Encyclopedia

Synonyms : PAEDMARYYSALRHYINLITRQRY-NH2; REF DUPL: H-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; H-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2; NPY (13-36) (HUMAN,RAT); PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2; L-Pro-L-Ala-L-Glu-L-Asp-L-Met-L-Ala-L-Arg-L-Tyr-L-Tyr-L-Ser-L-Ala-L-Leu-L-Arg-L-His-L-Tyr-L-Ile-L-Asp(NH2)-L-Leu-L-Ile-L-Thr-L-Arg-L-Gln-L-Arg-L-Tyr-NH2; NEUROPEPTIDE Y (13-36) HUMAN;

Supplier : All (16) China Suppliers (7) Price Available (2) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price
Career Henan Chemical Co	98%	3Day (s)	1kg	$2
Skyrun Industrial Co., Limited	99%	7Day (s)	25kg	Request For Qutation
Hefei Bopeptide Biotechnology Co., Ltd.	98%	14Day (s)	1mg	Request For Qutation
PolyPeptide Laboratories	95%	7Day (s)	0.5mg	$66
Chengdu SinoStandards Bio-Tech Co.,Ltd.	98%	7Day (s)	1mg	Request For Qutation

More Suppliers

: Check Encyclopedia

RANAKININ

CAS No. : 139446-71-2 Formula : C62H95N17O15S Molecular Weight. : 1350.59 Check Encyclopedia

Synonyms : Lys-Pro-Asn-Pro-Glu-Arg-Phe-Tyr-Gly-Leu-Met-NH2; H-LYS-PRO-ASN-PRO-GLU-ARG-PHE-TYR-GLY-LEU-MET-NH2;

Supplier : All (6) China Suppliers (3)

Recommended Supplier	Purity	Lead Time	Packing	Price
Skyrun Industrial Co., Limited	99%	7Day (s)	25kg	Request For Qutation
Hefei Saimanuo Biotechnology Co., Ltd.	95%	7Day (s)	5mg	Request For Qutation
American Custom Chemicals Corporation	96%	7Day (s)	100g	Request For Qutation
Nanjing Leon biological technology Co. LTD	98%	7Day (s)	1g	Request For Qutation
Ibookbio	96%	7Day (s)	500g	Request For Qutation

More Suppliers

: Check Encyclopedia

[D-Ala2]-Deltorphin II

CAS No. : 122752-16-3 Formula : C38H54N8O10 Molecular Weight. : 782.883 Check Encyclopedia

Synonyms : H-Tyr-D-Ala-Phe-Glu-Val-Val-Gly-NH2; deltorphin II; DELTORPHIN B; M.W. 782.89 C38H54N8O10; H2N-Tyr-D-Ala-Phe-Glu-Val-Val-Gly-NH2; Tyr-D-Ala-Phe-Glu-Val-Val-Gly amide; DADELT II; TYR-D-ALA-PHE-GLU-VAL-VAL-GLY-NH2;

Supplier : All (29) China Suppliers (10) Price Available (2) Contractor (5)

Recommended Supplier	Purity	Lead Time	Packing	Price
Career Henan Chemical Co	0.98	3Day (s)	1kg	Request For Qutation
Skyrun Industrial Co., Limited	99%	7Day (s)	25kg	Request For Qutation
Hangzhou Bingochem Co., Ltd.	97%	7Day (s)	25kg	Request For Qutation
ShangHai WeiHuan Biotech CO.,Ltd	98%	3Day (s)	10mg	$148
PolyPeptide Laboratories	97%	7Day (s)	1mg	$26

More Suppliers

: Check Encyclopedia

Nogo-66 (1-40)

CAS No. : 475221-20-6 Formula : C206H324N56O65 Molecular Weight. : 4625.11 Check Encyclopedia

Synonyms : ARG-ILE-TYR-LYS-GLY-VAL-ILE-GLN-ALA-ILE-GLN-LYS-SER-ASP-GLU-GLY-HIS-PRO-PHE-ARG-ALA-TYR-LEU-GLU-SER-GLU-VAL-ALA-ILE-SER-GLU-GLU-LEU-VAL-GLN-LYS-TYR-SER-ASN-SER-NH2; NEP1-40; AC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2; NOGO EXTRACELLULAR PEPTIDE,1-40; M.W. 4625.11 C206H324N56O65;

Supplier : All (12) China Suppliers (4) Price Available (2) Contractor (3)

Recommended Supplier	Purity	Lead Time	Packing	Price
BOC Sciences	>95%	1Week (s)	1mg	$519
Hangzhou J&H Chemical Co., Ltd.	98%	14Day (s)	1kg	Request For Qutation
Career Henan Chemical Co	98%	3Day (s)	10g	$1
ShangHai WeiHuan Biotech CO.,Ltd	98%	3Day (s)	10mg	$159
Chengdu SinoStandards Bio-Tech Co.,Ltd.	98%	7Day (s)	1mg	Request For Qutation

More Suppliers

: Check Encyclopedia

CART (62-76) (rat, human)

CAS No. : 210978-19-1 Formula : C64H99N17O23S3 Molecular Weight. : 1570.77 Check Encyclopedia

Synonyms : TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYS-ALA-VAL; H-TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYS-ALA-VAL-OH;

Supplier : All (11) China Suppliers (6) Price Available (1) Contractor (3)

Recommended Supplier	Purity	Lead Time	Packing	Price
Hangzhou J&H Chemical Co., Ltd.	98%	14Day (s)	1kg	Request For Qutation
Career Henan Chemical Co	98%	3Day (s)	10g	Request For Qutation
ShangHai WeiHuan Biotech CO.,Ltd	98%	3Day (s)	10mg	$214
Chengdu SinoStandards Bio-Tech Co.,Ltd.	98%	7Day (s)	1mg	Request For Qutation
Hefei Saimanuo Biotechnology Co., Ltd.	95%	7Day (s)	1g	Request For Qutation

More Suppliers

: Check Encyclopedia

[Phe22] Big Endothelin-1: 19-37, human

CAS No. : 189064-07-1 Formula : C104H152N26O26 Molecular Weight. : 2182.48 Check Encyclopedia

Synonyms : BIG ET-1 (19-37) (HUMAN),[PHE22]; H-ILE-ILE-TRP-VAL-ASN-THR-PRO-GLU-HIS-VAL-VAL-PRO-TYR-GLY-LEU-GLY-SER-PRO-ARG-OH; (phe22)-big endothelin 1 fragment 19-37; (PHE22)-BIG ET-1 (19-37) (HUMAN); BIG ENDOTHELIN-1 (19-37) (HUMAN),[PHE22]; [PHE22]-BIG ENDOTHELIN (19-37) (HUMAN); ILE-ILE-TRP-PHE-ASN-THR-PRO-GLU-HIS-VAL-VAL-PRO-TYR-GLY-LEU-GLY-SER-PRO-ARG; [PHE22] BIG ENDOTHELIN-1 (19-37),HUMAN; H-ILE-ILE-TRP-PHE-ASN-THR-PRO-GLU-HIS-VAL-VAL-PRO-TYR-GLY-LEU-GLY-SER-PRO-ARG-OH; (PHE22)-BIG ENDOTHELIN-1 FRAGMENT (19-37) (HUMAN);

Supplier : All (11) China Suppliers (5) Price Available (1) Contractor (2)

Recommended Supplier	Purity	Lead Time	Packing	Price
Career Henan Chemical Co	99.99%	3Day (s)	10g	Request For Qutation
Shanghai blue quarter Technology Development Co., Ltd.	99%	1Day (s)	1g	$45
Shenzhen Regent Biochemistry Technology CO., Ltd.	96%	7Day (s)	500g	Request For Qutation
Hefei Saimanuo Biotechnology Co., Ltd.	95%	7Day (s)	100mg	Request For Qutation
American Custom Chemicals Corporation	96%	7Day (s)	500g	Request For Qutation

More Suppliers

: Check Encyclopedia

Big Endothelin fragment 22-39 bovine

CAS No. : 133474-20-1 Formula : C83H130N24O27 Molecular Weight. : 1896.06 Check Encyclopedia

Synonyms :

Supplier : All (2) China Suppliers (1) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price	View
Career Henan Chemical Co	98%	3Day (s)	10g	Request For Qutation
American Peptide Company	95%	14Day (s)	1吨	Request For Qutation

More Suppliers

: Check Encyclopedia

Adrenocorticotropic Hormone

CAS No. : 53917-42-3 Formula : C112H165N27O36 Molecular Weight. : 2465.67 Check Encyclopedia

Synonyms : ProteoMass™ ACTH Fragment 18-39 MALDI-MS; Adrenocorticotropic hormone fragment 18-39; CLIP;

Supplier : All (24) China Suppliers (12) Price Available (2) Contractor (3)

Recommended Supplier	Purity	Lead Time	Packing	Price
BOC Sciences	≥95%	1Week (s)	2.5mg	$298
Hangzhou J&H Chemical Co., Ltd.	98%	14Day (s)	1kg	Request For Qutation
Career Henan Chemical Co	0.98	3Day (s)	1kg	Request For Qutation
Hefei Bopeptide Biotechnology Co., Ltd.	98%	14Day (s)	1mg	Request For Qutation
Saan Chemical Technology (Shanghai) Co., Ltd.	97%	1Day (s)	1mg	$167.12

More Suppliers

: Check Encyclopedia

|A-Endorphin rat

CAS No. : 77367-63-6 Formula : C157H254N42O44S Molecular Weight. : 3466.02 Check Encyclopedia

Synonyms :

Supplier : All (21) China Suppliers (15) Price Available (7) Contractor (4)

Recommended Supplier	Purity	Lead Time	Packing	Price
Hangzhou J&H Chemical Co., Ltd.	≥98%	7Day (s)	100g	Request For Qutation
Career Henan Chemical Co	0.98	3Day (s)	1kg	$1
Shanghai Miner Chemical Technology Co., Ltd.	97%	21Day (s)	500μg	$158
Zhejiang Peptites Biotech Co.,Ltd	0.98	7Day (s)	1g	Request For Qutation
Shanghai Civic Chemical Technology Co., Ltd.	97%	7Day (s)	0.5mg	$166.33

More Suppliers

: Check Encyclopedia

Neuropeptide Y Fragment 13-36 porcine

CAS No. : 113662-54-7 Formula : C135H209N41O36 Molecular Weight. : 2982.36 Check Encyclopedia

Synonyms : NPY 13-36;

Supplier : All (25) China Suppliers (9) Price Available (3) Contractor (3)

Recommended Supplier	Purity	Lead Time	Packing	Price
Hangzhou J&H Chemical Co., Ltd.	99%	14Day (s)	500g	Request For Qutation
Career Henan Chemical Co	98%	3Day (s)	10g	Request For Qutation
Skyrun Industrial Co., Limited	99%	7Day (s)	25kg	Request For Qutation
Hefei Bopeptide Biotechnology Co., Ltd.	98%	14Day (s)	1mg	Request For Qutation
Saan Chemical Technology (Shanghai) Co., Ltd.	97%	1Day (s)	5mg	$1172.93

More Suppliers

: Check Encyclopedia

Tumor Necrosis Factor-|A Human Fragment 46-65

CAS No. : 144796-72-5 Formula : C110H172N24O30 Molecular Weight. : 2310.69 Check Encyclopedia

Synonyms : Asn-Gln-Leu-Val-Val-Pro-Ser-Glu-Gly-Leu-Tyr-Leu-Ile-Tyr-Ser-Gln-Val-Leu-Phe-Lys;

Supplier : All (3) China Suppliers (2) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price
BOC Sciences	98%	1Week (s)	5mg	$298
Career Henan Chemical Co	98%	3Day (s)	10g	Request For Qutation
Nanjing Leon biological technology Co. LTD	98%	7Day (s)	50g	Request For Qutation
Bachem AG	96%	7Day (s)	25kg	Request For Qutation

More Suppliers

: Check Encyclopedia

THR-PHE-GLN-ALA-TYR-PRO-LEU-ARG-GLU-ALA

CAS No. : 117592-22-0 Formula : C55H82N14O16 Molecular Weight. : 1195.32 Check Encyclopedia

Synonyms : RETROVIRAL PROTEASE SUBSTRATE; T-F-Q-A-Y-P-L-R-E-A; H-Thr-Phe-Gln-Ala-Tyr-Pro-Leu-Arg-Glu-Ala-OH;

Supplier : All (6) China Suppliers (3) Price Available (1) Contractor (1)

Recommended Supplier	Purity	Lead Time	Packing	Price
Career Henan Chemical Co	98%	3Day (s)	10g	$1
Skyrun Industrial Co., Limited	99%	7Day (s)	25kg	Request For Qutation
Zhejiang Hongtuo Biotechnology Co., Ltd.	98%	5Day (s)	1g	Request For Qutation
American Custom Chemicals Corporation	96%	7Day (s)	10g	Request For Qutation
Ibookbio	96%	7Day (s)	10g	Request For Qutation

More Suppliers

All Categories